PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AA39G00244
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
Family SRS
Protein Properties Length: 333aa    MW: 37120.9 Da    PI: 6.44
Description SRS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AA39G00244genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF702221.12.3e-681212802152
      DUF702   2 rsgtasCqdCGnqakkdCaheRCRtCCksrgfdCathvkstWvpaakrrerqqqlaaasskaaasa..........aeaaskrkrel..kskkqsalss 88 
                 r+g+++CqdCGnqakkdC h+RCRtCCksrgf C+thvkstWvpaakrrerq+qlaa++s++  ++             + + + ++  ++++   l++
  AA39G00244 121 REGGMNCQDCGNQAKKDCIHMRCRTCCKSRGFLCQTHVKSTWVPAAKRRERQAQLAALQSREGVNNkakrlregseG--EGEAHDDDkgEADEGLVLAC 217
                 6799******************************************************9998887767788776431..22222222335667778889 PP

      DUF702  89 tklssaeskkeletsslPeevsseavfrcvrvssvddgeeelaYqtavsigGhvfkGiLydqGl 152
                  +l++ +s+  lets+lP+ev s+a+frc+rvss+dd+eee+aYqtavsigGh+fkGiLydqG+
  AA39G00244 218 NRLVNVNSS-GLETSNLPPEVTSPAMFRCMRVSSIDDEEEEYAYQTAVSIGGHIFKGILYDQGP 280
                 999998765.999**************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF051424.3E-63124280IPR007818Protein of unknown function DUF702
TIGRFAMsTIGR016233.0E-27126168IPR006510Zinc finger, lateral root primordium type 1
TIGRFAMsTIGR016248.1E-26233280IPR006511Lateral Root Primordium type 1, C-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009299Biological ProcessmRNA transcription
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 333 aa     Download sequence    Send to blast
MAGLFYLGGN RDHHNKQHHH QTKNHHNHDH QDQEKSNNYL YLYKDEIYNN NKAFEICPQY  60
FQEQQEVVVT TPPTNLYSFG MVPSGSSSNN NNRNRSLYFN INVSDDSLPL RSSIGGFTVS  120
REGGMNCQDC GNQAKKDCIH MRCRTCCKSR GFLCQTHVKS TWVPAAKRRE RQAQLAALQS  180
REGVNNKAKR LREGSEGEGE AHDDDKGEAD EGLVLACNRL VNVNSSGLET SNLPPEVTSP  240
AMFRCMRVSS IDDEEEEYAY QTAVSIGGHI FKGILYDQGP IDSTLTSQQQ QQLDTTTAGE  300
TNNNGLLDLY TAAAAAPFNA FVSGTPFFPL PRS
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00152DAPTransfer from AT1G19790Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0064344e-39AC006434.5 Genomic sequence for Arabidopsis thaliana BAC F10A5, complete sequence.
GenBankAC0237544e-39AC023754.3 Arabidopsis thaliana chromosome I BAC F1B16 genomic sequence, complete sequence.
GenBankAY8006204e-39AY800620.1 Arabidopsis thaliana clone H0000001204 hypothetical protein (AT1G75520) mRNA, complete cds.
GenBankAY9247304e-39AY924730.1 Arabidopsis thaliana hypothetical protein (At1g75520) mRNA, complete cds.
GenBankCP0026844e-39CP002684.1 Arabidopsis thaliana chromosome 1 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010498401.11e-144PREDICTED: protein SHI RELATED SEQUENCE 7-like
RefseqXP_010498402.11e-144PREDICTED: protein SHI RELATED SEQUENCE 7-like
SwissprotQ9FXH71e-135SRS7_ARATH; Protein SHI RELATED SEQUENCE 7
TrEMBLD7KI571e-133D7KI57_ARALL; Putative uncharacterized protein
STRINGfgenesh2_kg.1__2159__AT1G19790.11e-133(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM26452572
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G19790.21e-115SHI-related sequence 7